PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G381100.1.p
Common NameSb03g042080, SORBIDRAFT_03g042080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 278aa    MW: 30957.9 Da    PI: 9.641
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G381100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.1e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a++ifss+g+lyeyss
  Sobic.003G381100.1.p  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALVIFSSRGRLYEYSS 59
                          79***********************************************96 PP

2K-box107.61.4e-358417410100
                 K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           + +  +  qqe akL+++i++Lq+++Rhl+Ge++++++ keL+ Le++Le+++ +iRskKnelll++ie++qk+e +l++en+ Lr+k+
  Sobic.003G381100.1.p  84 DVNSLQFFQQETAKLRQQIQTLQNSNRHLMGESIGNMTAKELKGLENRLERGIGRIRSKKNELLLAEIEYMQKREADLHNENMFLRAKV 172
                           5567899*********************************************************************************9 PP

                 K-box  99 ee 100
                           +e
  Sobic.003G381100.1.p 173 AE 174
                           86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.54E-45275No hitNo description
SuperFamilySSF554552.88E-32274IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-323859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-2886172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.38988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALVIFSS RGRLYEYSSN  60
SVRSTIERYK KASASTSGTA PVIDVNSLQF FQQETAKLRQ QIQTLQNSNR HLMGESIGNM  120
TAKELKGLEN RLERGIGRIR SKKNELLLAE IEYMQKREAD LHNENMFLRA KVAEVERALQ  180
QEAAAEDQTM AMGPAAVGGA TTELKALPAS FDPRGYGYYQ QQQQQHVLAA ASAASSSQYS  240
EQPQGQGQQE YEYHHQTALH LGYHVKIHSA AGGKGFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-20173173Myocyte-specific enhancer factor 2B
1tqe_R1e-20173173Myocyte-specific enhancer factor 2B
1tqe_S1e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621100.0BT062110.1 Zea mays full-length cDNA clone ZM_BFb0215E12 mRNA, complete cds.
GenBankKJ7269310.0KJ726931.1 Zea mays clone pUT3477 MADS transcription factor (MADS41) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456758.10.0hypothetical protein SORBIDRAFT_03g042080
SwissprotQ8RU311e-131MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLC5XEN40.0C5XEN4_SORBI; Putative uncharacterized protein Sb03g042080
STRINGSb03g042080.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-95MIKC_MADS family protein